The domain within your query sequence starts at position 789 and ends at position 846; the E-value for the INCENP_ARK-bind domain shown below is 1.5e-22.
DLNSDDSTDDESHPRKPIPSWAKGTQLSQAIVHQYYHPPNILELFGSILPLDLEDIFK
INCENP_ARK-bind |
---|
PFAM accession number: | PF03941 |
---|---|
Interpro abstract (IPR005635): | This region of the inner centromere protein has been found to be necessary and sufficient for binding to aurora-related kinase. This interaction has been implicated in the coordination of chromosome segregation with cell division in yeast [ (PUBMED:11950927) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry INCENP_ARK-bind