The domain within your query sequence starts at position 1 and ends at position 253; the E-value for the IP_trans domain shown below is 3.2e-130.
MIIKEYRIPLPMTVDEYRIAQLYMIQKKSRNETHGQGSGVEILENRPYTDGPGGSGQYTH KVYHVGMHIPGWFRSILPKAALRVVEESWNAYPYTRTRFTCPFVEKFSIDIETFYKTDTG ENNNVFNLSPVEKSQLITDIIDIVKDPVPPSEYKTEEDPKLFQSVKTCRGPLSENWIQEY KKRLLPIMCAYKLCKVEFRYWGMQSKIERFIHDTGLRRVMVRAHRQAWCWQDEWYGLTME KIRELEREVQLML
IP_trans |
![]() |
---|
PFAM accession number: | PF02121 |
---|---|
Interpro abstract (IPR001666): | Phosphatidylinositol transfer protein (PITP) is a ubiquitous cytosolic protein, thought to be involved in transport of phospholipids from their site of synthesis in the endoplasmic reticulum and Golgi to other cell membranes [ (PUBMED:7774006) ]. More recently, PITP has been shown to be an essential component of the polyphosphoinositide synthesis machinery and is hence required for proper signalling by epidermal growth factor and f-Met-Leu-Phe, as well as for exocytosis. The role of PITP in polyphosphoinositide synthesis may also explain its involvement in intracellular vesicular traffic [ (PUBMED:7774006) ]. |
GO process: | phospholipid transport (GO:0015914) |
GO function: | phospholipid transporter activity (GO:0005548) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IP_trans