SMART: Pfam domain IR1-M

The domain within your query sequence starts at position 2544 and ends at position 2604; the E-value for the IR1-M domain shown below is 7e-30.

ECVIVWEKKPTVEERAKADTLKLPPTFFCGVCSDTDEDNGNGEDFQSELRKVCEAQKSQN
E

IR1-M

PFAM accession number:	PF12185
Interpro abstract (IPR022011):	This domain family is found in eukaryotes, and is approximately 60 amino acids in length. The family is found in association with . There are two conserved sequence motifs: TFFC and EDF. Nup358/RanBP2 is a nucleoporin involved in ubiquitination of many different protein targets from various cellular pathways. It complexes with Ubc9, SUMO-1 and RanGAP1 to perform this function. This is the ligase domain which binds to Ubc9.

PFAM accession number:

PF12185

Interpro abstract (IPR022011):

This domain family is found in eukaryotes, and is approximately 60 amino acids in length. The family is found in association with . There are two conserved sequence motifs: TFFC and EDF. Nup358/RanBP2 is a nucleoporin involved in ubiquitination of many different protein targets from various cellular pathways. It complexes with Ubc9, SUMO-1 and RanGAP1 to perform this function. This is the ligase domain which binds to Ubc9.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IR1-M