The domain within your query sequence starts at position 8 and ends at position 59; the E-value for the IRF-2BP1_2 domain shown below is 9.5e-37.
RRQWCYLCDLPKMPWAMVWDFSEAVCRGCVNFEGADRIELLIDAARQLKRSH
IRF-2BP1_2 |
---|
PFAM accession number: | PF11261 |
---|---|
Interpro abstract (IPR022750): | This entry represents the N-terminal zinc finger domain of IRF-2BP1 and IRF-2BP2. IRF-2BP1 and IRF-2BP2 are nuclear transcriptional repressor proteins and can inhibit both enhancer-activated and basal transcription. They both contain N-terminal zinc finger and C-terminal RING finger domains [ (PUBMED:12799427) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IRF-2BP1_2