The domain within your query sequence starts at position 8 and ends at position 59; the E-value for the IRF-2BP1_2 domain shown below is 9.5e-37.

RRQWCYLCDLPKMPWAMVWDFSEAVCRGCVNFEGADRIELLIDAARQLKRSH

IRF-2BP1_2

IRF-2BP1_2
PFAM accession number:PF11261
Interpro abstract (IPR022750):

This entry represents the N-terminal zinc finger domain of IRF-2BP1 and IRF-2BP2.

IRF-2BP1 and IRF-2BP2 are nuclear transcriptional repressor proteins and can inhibit both enhancer-activated and basal transcription. They both contain N-terminal zinc finger and C-terminal RING finger domains [ (PUBMED:12799427) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IRF-2BP1_2