The domain within your query sequence starts at position 30 and ends at position 103; the E-value for the Ig_4 domain shown below is 5.9e-23.
EDKVFVTCNTSVMHLDGTVEGWFAKNKTLNLGKGVLDPRGIYLCNGTEQLAKVVSSVQVH YRMCQNCVELDSGT
Ig_4 |
 |
|---|
| PFAM accession number: | PF16680 |
|---|---|
| Interpro abstract (IPR032052): | This is an immunoglobulin-like domain. It is found on the T-cell surface glycoprotein CD3 gamma/delta chain. CD3delta and CD3epsilon complex together as part of the T-cell receptor complex [ (PUBMED:15534202) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ig_4