The domain within your query sequence starts at position 262 and ends at position 359; the E-value for the Il2rg domain shown below is 1.1e-32.

RFCHVNNQEFLVNSNCSVLLLLHYIRKKMKLRKTDTIDLCDESGTMKLLFLSKTPGDSAS
KFLTARNTYYVCKVERGAPGTRIENSYKAIVPMLKNPE

Il2rg

• PFAM accession number: PF15874
• Interpro abstract (IPR039471):

  The function of this group of proteins is not known. Proteins in this entry includes CXorf65 and C22orf15 from humans.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Il2rg