The domain within your query sequence starts at position 307 and ends at position 420; the E-value for the Inos-1-P_synth domain shown below is 6.3e-48.

GQTKVKSVLVDFLIGSGLKTMSIVSYNHLGNNDGQNLSAPLQFRSKEVTKSSVVDDMVHS
NHVLYAPGERPDHCVVIKYVPYVGDSKRALDEYTSELMLGGTNTLVLHNTCEDS

Inos-1-P_synth

Inos-1-P_synth
PFAM accession number:PF01658
Interpro abstract (IPR013021):

This is a region of myo-inositol-1-phosphate synthases that is related to the glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain.

1L-myo-Inositol-1-phosphate synthase ( EC 5.5.1.4 ) catalyzes the conversion of D-glucose 6-phosphate to 1L-myo-inositol-1-phosphate, the first committed step in the production of all inositol-containing compounds, including phospholipids, either directly or by salvage. The enzyme exists in a cytoplasmic form in a wide range of plants, animals, and fungi. It has also been detected in several bacteria and a chloroplast form is observed in alga and higher plants. Inositol phosphates play an important role in signal transduction.

In Saccharomyces cerevisiae (Baker's yeast), the transcriptional regulation of the INO1 gene has been studied in detail [ (PUBMED:7975896) ] and its expression is sensitive to the availability of phospholipid precursors as well as growth phase. The regulation of the structural gene encoding 1L-myo-inositol-1-phosphate synthase has also been analyzed at the transcriptional level in the aquatic angiosperm, Spirodela polyrrhiza (Giant duckweed) and the halophyte, Mesembryanthemum crystallinum (Common ice plant) [ (PUBMED:9370339) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Inos-1-P_synth