The domain within your query sequence starts at position 192 and ends at position 256; the E-value for the Integrase_DNA domain shown below is 3.4e-24.
EKEQKEQEEKQRKAEELLQELKHLKIKVEELENERNQYEWELKATKAEVAQLQEQVALKD AEIER
Integrase_DNA |
![]() |
---|
PFAM accession number: | PF02920 |
---|---|
Interpro abstract (IPR004191): | The integrase family of site-specific recombinases catalyze a diverse array of DNA rearrangements in archaebacteria, eubacteria and yeast. The structure of the DNA binding domain of the the conjugative transposon Tn916 integrase protein was determined using NMR spectroscopy. The N-terminal domain was found to be structurally similar to the double stranded RNA binding domain (dsRBD). Experimental evidence suggests that the integrase protein interacts with DNA using residues located on the face of its three stranded beta-sheet [ (PUBMED:9665166) ]. |
GO process: | DNA integration (GO:0015074) |
GO function: | integrase activity (GO:0008907), DNA binding (GO:0003677) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Integrase_DNA