The domain within your query sequence starts at position 1 and ends at position 144; the E-value for the Integrin_alpha2 domain shown below is 7.8e-24.
XELFFINMWQKEEMGISCELLESDFLKCSVGFPFMRSKSKYEFSVIFDTSHLSGEEEILS FIVTAQSGNLERSEALHDNTLTLTVPLVHEVDTSITGIVSPTSFVYGESVDASNFIQLDD QECHFQPVNITLQVPTGPGCDRSR
Integrin_alpha2 |
---|
PFAM accession number: | PF08441 |
---|---|
Interpro abstract (IPR013649): | This domain is found in integrin alpha and integrin alpha precursors to the C terminus of a number of FG-GAP repeats ( IPR013517 ). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Integrin_alpha2