The domain within your query sequence starts at position 138 and ends at position 245; the E-value for the Interfer-bind domain shown below is 5.1e-26.
TNLGQPVIQQFEQDGRKLNVVVKDSLTLVRKNGTFLTLRQVFGKDLGYIITYRKGSSTGK KTNITNTNEFSIDVEEGVSYCFFVQAMIFSRKTNQNSPGSSTVCTEQW
Interfer-bind |
---|
PFAM accession number: | PF09294 |
---|---|
Interpro abstract (IPR015373): | Proteins with this domains have a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology. They include interferon receptors, tissue factor proteins and interleukin receptors. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Interfer-bind