SMART: Pfam domain Involucrin

The domain within your query sequence starts at position 1 and ends at position 67; the E-value for the Involucrin_N domain shown below is 2e-32.

MSHQHTLPVTVPAVVQGPLKTVCSPDHIQQEQAKQPTPHPTQCQVFTEIQEKGFPKHEEK
RPNPVKD

Involucrin_N

PFAM accession number:	PF10583
Interpro abstract (IPR019571):	Involucrin [ (PUBMED:1359382) (PUBMED:8277848) ] is a highly reactive, soluble, transglutaminase substrate protein present in keratinocytes of epidermis and other stratified squamous epithelia. Involucrin first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase thus helping in the formation of an insoluble envelope beneath the plasma membrane [ (PUBMED:8098344) ] functioning as a glutamyl donor during assembly of the cornified envelope. Structurally involucrin consists of a conserved region of about 75 amino acid residues followed by two extremely variable length segments that contain glutamine-rich tandem repeats. The glutamine residues in the tandem repeats are the substrate for the tranglutaminase in the cross-linking reaction. The total size of the protein varies from 285 residues (in dog) to 835 residues (in orangutan). This is the N-terminal three beta strands of involucrin, a protein present in keratinocytes of epidermis and other stratified squamous epithelia. Apigenin is a plant-derived flavanoid that has significant promise as a skin cancer chemopreventive agent. It has been found that apigenin regulates normal human keratinocyte differentiation by suppressing it and this is associated with reduced cell proliferation without apoptosis [ (PUBMED:16982614) ]. The downstream part of the protein is represented by IPR000354 .

PFAM accession number:

PF10583

Interpro abstract (IPR019571):

Involucrin [ (PUBMED:1359382) (PUBMED:8277848) ] is a highly reactive, soluble, transglutaminase substrate protein present in keratinocytes of epidermis and other stratified squamous epithelia. Involucrin first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase thus helping in the formation of an insoluble envelope beneath the plasma membrane [ (PUBMED:8098344) ] functioning as a glutamyl donor during assembly of the cornified envelope.

Structurally involucrin consists of a conserved region of about 75 amino acid residues followed by two extremely variable length segments that contain glutamine-rich tandem repeats. The glutamine residues in the tandem repeats are the substrate for the tranglutaminase in the cross-linking reaction. The total size of the protein varies from 285 residues (in dog) to 835 residues (in orangutan).

This is the N-terminal three beta strands of involucrin, a protein present in keratinocytes of epidermis and other stratified squamous epithelia. Apigenin is a plant-derived flavanoid that has significant promise as a skin cancer chemopreventive agent. It has been found that apigenin regulates normal human keratinocyte differentiation by suppressing it and this is associated with reduced cell proliferation without apoptosis [ (PUBMED:16982614) ]. The downstream part of the protein is represented by IPR000354 .

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Involucrin_N