The domain within your query sequence starts at position 776 and ends at position 1006; the E-value for the Ion_trans domain shown below is 1e-51.

KKLARTASPEKKQEVMEKPAVEESKEEKIELKSITADGESPPTTKINMDDLQPSENEDKS
PHSNPDTAGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPNNRFRLQCHR
IVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHILGNADYVFTSIFTLEIILKMTAY
GAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPL

Ion_trans

• PFAM accession number: PF00520
• Interpro abstract (IPR005821):

  This domain is found in sodium, potassium, and calcium ion channels proteins. The proteins have 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some Na channel proteins the domain is repeated four times, whereas in others (e.g. K channels) the protein forms a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not included in the Pfam family due to it lacking the first four helices.

• GO process: transmembrane transport (GO:0055085), ion transport (GO:0006811)
• GO component: membrane (GO:0016020)
• GO function: ion channel activity (GO:0005216)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ion_trans