The domain within your query sequence starts at position 102 and ends at position 183; the E-value for the Ion_trans_2 domain shown below is 2.4e-21.

HACVNSTELDELIQDLETSPHELKVEKYSASSMPCWEFPSLAFYWLGLVIS

Ion_trans_2

Ion_trans_2
PFAM accession number:PF07885
Interpro abstract (IPR013099):

This domain is found in a variety of potassium channel proteins, including the two membrane helix type ion channels found in bacteria [ (PUBMED:11836519) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ion_trans_2