The domain within your query sequence starts at position 87 and ends at position 130; the E-value for the Ion_trans_N domain shown below is 8.2e-24.
FTSMLQPGVNKFSLRMFGSQKAVEKEQERVKTAGFWIIHPYSDF
Ion_trans_N |
---|
PFAM accession number: | PF08412 |
---|---|
Interpro abstract (IPR013621): | This domain is found to the N terminus of IPR005821 in voltage- and cyclic nucleotide-gated K/Na ion channels. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ion_trans_N