The domain within your query sequence starts at position 47 and ends at position 152; the E-value for the Ipi1_N domain shown below is 3.4e-24.
RTEHISPFFPLVSAHLSSAMTHITEGIQEDSLKVLDILLEHYPALITGRSSILLKNFVEL ISHQQLSKGLVNRDRSQSWILSVNPNRRVTSQQWRLKVLARLSKFL
Ipi1_N |
---|
PFAM accession number: | PF12333 |
---|---|
Interpro abstract (IPR024679): | This entry represents a domain found in the N terminus of the pre-rRNA-processing protein Ipi1. This domain can also be found in testis-expressed sequence 10 protein (TEX10). In Saccharomyces cerevisiae, Ipi1 is a component of the RIX1 complex required for processing of ITS2 sequences from 35S pre-rRNA [ (PUBMED:15528184) (PUBMED:14759368) ]. In humans, TEX10 is a component of some MLL1/MLL complex, a protein complex that can methylate lysine-4 of histone H3 [ (PUBMED:15960975) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ipi1_N