The domain within your query sequence starts at position 49 and ends at position 130; the E-value for the Itfg2 domain shown below is 3.9e-29.

KNDDSRPWLTCMCQGMLTCVGVGDVCNKGKNLVVAVSAEGWLHLFDLTPTKALDASGHHE
TLGEEQRPVFKQHIPANTKMEM

Itfg2

Itfg2
PFAM accession number:PF15907
Interpro abstract (IPR031793):

Integrin-alpha FG-GAP repeat-containing protein 2 (ITFG2) may play a critical role in B cell differentiation and development of autoimmunity [ (PUBMED:23997217) ]. It is a component of protein complex KICSTOR, also composed of KPTN, C12orf66 and SZT2, which is required for inhibition of mTORC1 as a result of amino acid or glucose deprivation [ (PUBMED:28199306) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Itfg2