The domain within your query sequence starts at position 529 and ends at position 608; the E-value for the KELK domain shown below is 1.1e-32.
QIKASEKQIKTLQQEREELNKELVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTE LHTQKQKLARHVRDKEEEVD
KELK |
 |
|---|
| PFAM accession number: | PF15796 |
|---|---|
| Interpro abstract (IPR031597): | KELK is a domain of eukaryotic proteins found in serine/threonine-protein kinase MRCK-type proteins [ (PUBMED:9418861) ]. The region is low-complexity, but it is not a predicted disordered-binding domain. The name comes from a highly conserved sequence motif within the domain. The function is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry KELK