The domain within your query sequence starts at position 40 and ends at position 119; the E-value for the KR domain shown below is 1.5e-16.

SVLITGGGRGIGRHLAREFAERGARKIVLWGRTEKCLKETTEEIRQMGTECHYFICDVGN
REEVYQMAKAVREKTQLVWH

KR

KR
PFAM accession number:PF08659
Interpro abstract (IPR013968):

This domain is found in polyketide and fatty acid synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain. It uses NADPH to reduce the keto group to a hydroxy group [ (PUBMED:23790488) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry KR