The domain within your query sequence starts at position 18 and ends at position 88; the E-value for the KTI12 domain shown below is 5.6e-8.

LGLCVLCGLPAAGKSTFARALALRLRRERGWAVGVLSYDDVLPLALPDCDGTQPRPSQWK
MFRQELLKHLE

KTI12

KTI12
PFAM accession number:PF08433
Interpro abstract (IPR013641):

Protein KTI12 is a chromatin associated protein that interacts with the Elongator complex, a component of the elongating form of RNA polymerase II [ (PUBMED:15772087) ]. The Elongator complex has histone acetyltransferase activity.

L-seryl-tRNA(Sec) kinase (PSTK) specifically phosphorylates seryl-tRNA(Sec) to O-phosphoseryl-tRNA(Sec), an activated intermediate for selenocysteine biosynthesis [ (PUBMED:15317934) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry KTI12