The domain within your query sequence starts at position 4 and ends at position 163; the E-value for the Keratin_2_head domain shown below is 1.5e-46.
QFSSQSAFSSRSRRAYSSRSSSGFGGGRQALVSVSQSRRYGGDYGGGFSSRSLYSLGGSK SIFGNLVGRSASGFCQSRGPGGGFGGGIGGGIGGGRGFGGGGFGGGYGGGGRFGGGFGGA GFGFGGFGPSYPPGGIHEVTINQSLLEPLHLEVDPEIQRV
Keratin_2_head |
![]() |
---|
PFAM accession number: | PF16208 |
---|---|
Interpro abstract (IPR032444): | All intermediate filament proteins feature a central alpha-helical rod domain and variable nonhelical domains located at the N-terminal (head) and C-terminal (tail). The central rod domain is the main driver of self-assembly into filaments, whereas the N- and C-terminal domains are involved in post-translational modifications and interactions with other proteins [ (PUBMED:16710422) ]. Type I and type II keratin form heteropolymeric intermediate filaments providing vital mechanical support in epithelia [ (PUBMED:22705788) ]. This entry represents the N-terminal domain (head) of type II keratins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Keratin_2_head