The domain within your query sequence starts at position 1 and ends at position 134; the E-value for the Keratin_assoc domain shown below is 1.2e-61.
MQIYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLENLVFGKGFQAKIFPEILLCLLLA LFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQATAPVLTPAKITGKGKKRN
Keratin_assoc |
![]() |
---|
PFAM accession number: | PF09775 |
---|---|
Interpro abstract (IPR018614): | Members of this family comprise various keratinocyte-associated proteins. The function of these proteins is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Keratin_assoc