The domain within your query sequence starts at position 87 and ends at position 215; the E-value for the Keratin_assoc domain shown below is 2.5e-57.

GLIHRVCVTTCFIFSMVGLYYINKISSTLYQATAPVLTPAKITGKGKKRN

Keratin_assoc

Keratin_assoc
PFAM accession number:PF09775
Interpro abstract (IPR018614):

Members of this family comprise various keratinocyte-associated proteins. The function of these proteins is not known.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Keratin_assoc