The domain within your query sequence starts at position 1 and ends at position 195; the E-value for the L6_membrane domain shown below is 1.2e-96.

MCYVKCARYIGYSLVWAAVFCIVANALLYFPNGETKYATEDHLSRFVWYFAGIVGGGLLM
LLPAFVFIGMDEEDCCGCCGYENYGKRCSMLSSVLAALIGIVGSAYCVIVASLGLAEGPK
CSDAHGVWNYTFASTEGQYLLNSSMWSKCYEPKHIVEWHVTLFSILLAFAAVEFILCLIQ
VINGMLGGLCGYCCS

L6_membrane

• PFAM accession number: PF05805
• Interpro abstract (IPR008661):

  This family consists of several eukaryotic L6 membrane proteins. L6, IL-TMP, and TM4SF5 are cell surface proteins predicted to have four transmembrane domains. Previous sequence analysis led to their assignment as members of the tetraspanin superfamily it has now been found that that they are not significantly related to genuine tetraspanins, but instead constitute their own L6 family [ (PUBMED:10975581) ]. Several members of this family have been implicated in Homo sapiens cancer [ (PUBMED:1565644) (PUBMED:9479038) ].

• GO component: integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry L6_membrane