The domain within your query sequence starts at position 74 and ends at position 190; the E-value for the LAP1C domain shown below is 5.7e-49.
RDQDFPAHENQPLLLTSGCQENPQEWVDRAVRMRSRMAYNNIQKSNFGNQSPSTSRPQSA IHHPNEPSVKIKWWLLGLVAILAVGLFWFFHTPAVETTAVQEFQNQMKQLQSKYQSQ
LAP1C |
![]() |
---|
PFAM accession number: | PF05609 |
---|---|
Interpro abstract (IPR008662): | This entry contains Rattus norvegicus LAP1C proteins and several uncharacterised highly related sequences from both Mus sp. and humans. Lamina-associated polypeptide 1s (LAP1s), also known as Torsin-1A-interacting protein 1, are type 2 integral membrane proteins with a single membrane-spanning region of the inner nuclear membrane [ (PUBMED:12061773) ]. LAP1s bind to both A- and B-type lamins and have a putative role in the membrane attachment and assembly of the nuclear lamina [ (PUBMED:7721789) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry LAP1C