The domain within your query sequence starts at position 325 and ends at position 387; the E-value for the LAS2 domain shown below is 9.2e-17.
YEGLGNEFKCQCDNPLLPGQSQKPFCGDKIELLILKAKKNLKQSAKDLPKPVEKDDSPCS LDK
LAS2 |
![]() |
---|
PFAM accession number: | PF15792 |
---|---|
Interpro abstract (IPR031587): | LAS2 is a family of eukaryotic proteins. Deletion of LAS2 is observed in approx. 40% of human lung adenocarcinomas, suggesting that loss of function of LAS2 may be a key step for promoting lung tumourigenesis [ (PUBMED:19622765) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry LAS2