The domain within your query sequence starts at position 75 and ends at position 114; the E-value for the LEM domain shown below is 5.8e-9.
KLLNPDDLRKEVMKAGLKCGPITSTTRFIFEKKLAQALLE
LEM |
![]() |
---|
PFAM accession number: | PF03020 |
---|---|
Interpro abstract (IPR003887): | The LEM (LAP2, emerin, MAN1) domain is a globular module of approximately 40 amino acids, which is mostly found in the nucleoplasmic portions of metazoan inner nuclear membrane proteins. The LEM domain has been shown to mediate binding to BAF (barrier-to-autointegration factor) and BAF-DNA complexes. BAF dimers bind to double-stranded DNA non-specifically and thereby bridge DNA molecules to form a large, discrete nucleoprotein complex [ (PUBMED:10671519) (PUBMED:11500367) ]. The resolution of the solution structure of the LEM domain reveals that it is composed of a three-residue N-terminal helical turn and two large parallel alpha helices interacting through a set of conserved hydrophobic amino acids. The two helices, which are connected by a long loop are oriented at an angle of ~45 degree [ (PUBMED:11500367) (PUBMED:11435115) ]. Proteins known to contain a LEM domain include:
|
This is a PFAM domain. For full annotation and more information, please see the PFAM entry LEM