The domain within your query sequence starts at position 1 and ends at position 61; the E-value for the LEP503 domain shown below is 6.1e-39.
MRPPTQPLTQALPFSLRDALRGTGLQVPVIKMGTGWEGMYRTLKEVAYILLCCWCIKELL D
LEP503 |
---|
PFAM accession number: | PF15221 |
---|---|
Interpro abstract (IPR029194): | This protein may be involved in lens epithelial cell differentiation [ (PUBMED:10655141) (PUBMED:11376938) ]. |
GO process: | multicellular organism development (GO:0007275) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry LEP503