SMART: Pfam domain LETM1

The domain within your query sequence starts at position 152 and ends at position 417; the E-value for the LETM1 domain shown below is 1.2e-111.

LGQKVLDELRHYYHGFRLLWIDTKIAARMLWRILNGHTLTRRERRQFLRICADLFRLVPF
LVFVVVPFMEFLLPVVVKLFPNMLPSTFETQSIKEERLKKELRVKLELAKFLQDTIEEMA
LKNKAAKGNATKDFSAFFQKIRETGERPSNEEIMRFSKLFEDELTLDNLTRPQLVALCKL
LELQSIGTNNFLRFQLTMRLRSIKADDKLISEEGVDSLTVKELQAACRARGMRALGVTED
RLKGQLKQWLDLHLHHEIPTSLLILS

LETM1

PFAM accession number:	PF07766
Interpro abstract (IPR011685):	This is a group of mainly hypothetical eukaryotic proteins. Putative features found in LETM1, such as a transmembrane domain and a CK2 and PKC phosphorylation site [ (PUBMED:10486213) ], are relatively conserved throughout the family. Deletion of LETM1 is thought to be involved in the development of Wolf-Hirschhorn syndrome in humans [ (PUBMED:10486213) ]. A member of this family, P91927 is known to be expressed in the mitochondria of Drosophila melanogaster [ (PUBMED:10071211) ], suggesting that this may be a group of mitochondrial proteins.

PFAM accession number:

PF07766

Interpro abstract (IPR011685):

This is a group of mainly hypothetical eukaryotic proteins. Putative features found in LETM1, such as a transmembrane domain and a CK2 and PKC phosphorylation site [ (PUBMED:10486213) ], are relatively conserved throughout the family. Deletion of LETM1 is thought to be involved in the development of Wolf-Hirschhorn syndrome in humans [ (PUBMED:10486213) ]. A member of this family, P91927 is known to be expressed in the mitochondria of Drosophila melanogaster [ (PUBMED:10071211) ], suggesting that this may be a group of mitochondrial proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LETM1