The domain within your query sequence starts at position 84 and ends at position 240; the E-value for the LIN37 domain shown below is 5e-51.
LAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICRAWMRNSPTVRERERSPGSPLPPL PEDGEGSEVINSKNRDVYKLPPPTAPGPLGDACRSRIPSPLQPETEGTPDDEPSEPEPSP STLIYRNMQRWKRIRQRWKEASHRNQLRYSESMKILR
LIN37 |
---|
PFAM accession number: | PF15306 |
---|---|
Interpro abstract (IPR028226): | This entry represent LIN37 and related proteins from animals and plants. In humans, LIN37 is a component of the DREAM (MuvB/DRM) complex, which represses cell cycle-dependent genes in quiescent cells and plays a role in the cell cycle-dependent activation of G2/M genes [ (PUBMED:17531812) (PUBMED:17671431) ]. |
GO component: | transcription repressor complex (GO:0017053) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry LIN37