The domain within your query sequence starts at position 155 and ends at position 244; the E-value for the LINES_N domain shown below is 1.1e-26.
ILTAVIKEILKDTHSQRAESLKQLLTPFDITFEVFYNSLFSQHFGDFQSPSNLASSLMCF LELLELLVASRIHLKLHFRSQRMLFLKPHA
LINES_N |
![]() |
---|
PFAM accession number: | PF14694 |
---|---|
Interpro abstract (IPR032794): | This entry represents the N terminus of protein lines [ (PUBMED:12119551) ]. In Drosophila this protein is involved in embryonic segmentation and may function as a transcriptional regulator [ (PUBMED:8241770) (PUBMED:11846473) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry LINES_N