The domain within your query sequence starts at position 52 and ends at position 99; the E-value for the LLC1 domain shown below is 6.6e-6.
GVQQDQLWRELVEAEARGQRRWAENWGFLKDYDPLGNKKEPQELPASV
LLC1 |
---|
PFAM accession number: | PF14945 |
---|---|
Interpro abstract (IPR020339): | Uncharacterised protein C20orf85 is part of a family found in eukaryotes. It is 137 amino acids long in protein sequence length and mass is approximately 15.7kDa. The protein is present in the normal lung epithelium, but absent or downregulated in most primary non-small lung cancers. The gene is known as Low in Lung Cancer 1 (LLC1). This protein is thought to have a role in the maintenance of normal lung function and its absence may lead to lung tumourigenesis [ (PUBMED:17304513) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry LLC1