The domain within your query sequence starts at position 284 and ends at position 396; the E-value for the LLGL domain shown below is 8.6e-45.
PFQTTVPHGKSQREGRKSESCKPILKVEYKTCRNSEPFIIFSGGLSYDKACRRPSLTIMH GKAITVLEMDHPIVEFLTLCETPYPNEFQEPYAVAVLLEKDLIVVDLTQTNFP
LLGL |
![]() |
---|
PFAM accession number: | PF08366 |
---|---|
Interpro abstract (IPR013577): | This domain is found in lethal giant larvae homologue 2 (LLGL2) proteins and syntaxin-binding proteins like tomosyn [ (PUBMED:14767561) ]. It has been identified in eukaryotes and tends to be found together with WD repeats ( IPR001680 ). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry LLGL