The domain within your query sequence starts at position 240 and ends at position 285; the E-value for the LMSTEN domain shown below is 1.2e-29.
GNCVEHVQTSAFIQQPFVDEDPDKEKKIKELELLLMSAENEVRRKR
LMSTEN |
---|
PFAM accession number: | PF07988 |
---|---|
Interpro abstract (IPR012642): | Proteins containing the Wos2 domain are involved in the regulation of the cell cycle [ (PUBMED:10581266) ] and are Myb-related transcriptional activators. |
GO process: | regulation of transcription, DNA-templated (GO:0006355) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry LMSTEN