The domain within your query sequence starts at position 117 and ends at position 158; the E-value for the LRR_4 domain shown below is 7.2e-11.
HLQVLWLARCGLTDLDGIGSFLELKELYVSYNNISDLSPLCL
LRR_4 |
![]() |
---|
PFAM accession number: | PF12799 |
---|---|
Interpro abstract (IPR025875): | This entry represents 2 copies of a leucine rich repeat. Leucine rich repeats are short sequence motifs present in a number of proteins with diverse functions and cellular locations. These repeats are usually involved in protein-protein interactions. Each leucine rich repeat is composed of a beta-alpha unit. These units form elongated non-globular structures. Leucine rich repeats are often flanked by cysteine rich domains [ (PUBMED:7817399) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry LRR_4