SMART: Pfam domain LRR

The domain within your query sequence starts at position 138 and ends at position 177; the E-value for the LRR_4 domain shown below is 9.1e-8.

LELKELYVSYNNISDLSPLCLLEQLEVLDLEGNNVEDLGQ

LRR_4

PFAM accession number:	PF12799
Interpro abstract (IPR025875):	This entry represents 2 copies of a leucine rich repeat. Leucine rich repeats are short sequence motifs present in a number of proteins with diverse functions and cellular locations. These repeats are usually involved in protein-protein interactions. Each leucine rich repeat is composed of a beta-alpha unit. These units form elongated non-globular structures. Leucine rich repeats are often flanked by cysteine rich domains [ (PUBMED:7817399) ].

PFAM accession number:

PF12799

Interpro abstract (IPR025875):

This entry represents 2 copies of a leucine rich repeat.

Leucine rich repeats are short sequence motifs present in a number of proteins with diverse functions and cellular locations. These repeats are usually involved in protein-protein interactions. Each leucine rich repeat is composed of a beta-alpha unit. These units form elongated non-globular structures. Leucine rich repeats are often flanked by cysteine rich domains [ (PUBMED:7817399) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry LRR_4