The domain within your query sequence starts at position 182 and ends at position 230; the E-value for the LSR domain shown below is 2e-23.
EWVFVGLVILGIFLFFVLVGICWCQCCPHSCCCYVRCPCCPDSCCCPQA
LSR |
---|
PFAM accession number: | PF05624 |
---|---|
Interpro abstract (IPR008664): | This domain consists of mammalian LISCH7 protein homologues. LISCH7 is a liver-specific BHLH-ZIP transcription factor. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry LSR