The domain within your query sequence starts at position 22 and ends at position 93; the E-value for the LST1 domain shown below is 5e-47.
LGGLLLLLVIILFICLCRFSQRVKRLERNAQVSGQEPHYASLQQLPVSSSDITDMKEDLS TDYACIARSTPT
LST1 |
 |
|---|
| PFAM accession number: | PF05083 |
|---|---|
| Interpro abstract (IPR007775): | B144/LST1 is a gene encoded in the human major histocompatibility complex that produces multiple forms of alternatively spliced mRNA and encodes peptides fewer than 100 amino acids in length. B144/LST1 is strongly expressed in dendritic cells. Transfection of B144/LST1 into a variety of cells induces morphologic changes including the production of long, thin filopodia [ (PUBMED:11478849) ]. A possible role in modulating immune responses. Induces morphological changes including production of filopodia and microspikes when overexpressed in a variety of cell types and may be involved in dendritic cell maturation. Isoform 1 and isoform 2 have an inhibitory effect on lymphocyte proliferation [ (PUBMED:10706707) (PUBMED:11478849) ]. |
| GO process: | immune response (GO:0006955), cell morphogenesis (GO:0000902) |
| GO component: | membrane (GO:0016020) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry LST1