The domain within your query sequence starts at position 7 and ends at position 113; the E-value for the Lactamase_B domain shown below is 3.3e-16.
PVLEDNYMYLIIEEHTREAVAIDVAVAERLLEIAGREGVSLTMVLSTHHHWDHTRGNAEL AHILPGLAVLGADERICALTRRLEHGEGLQFGAIHVRCLLTPGHTSG
Lactamase_B |
---|
PFAM accession number: | PF00753 |
---|---|
Interpro abstract (IPR001279): | Apart from the beta-lactamases and metallo-beta-lactamases, a number of other proteins contain this domain [ (PUBMED:7588620) ]. These proteins include thiolesterases, members of the glyoxalase II family, that catalyse the hydrolysis of S-D-lactoyl-glutathione to form glutathione and D-lactic acid and a competence protein that is essential for natural transformation in Neisseria gonorrhoeae and could be a transporter involved in DNA uptake. Except for the competence protein these proteins bind two zinc ions per molecule as cofactor. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Lactamase_B