SMART: Pfam domain Laps

The domain within your query sequence starts at position 3 and ends at position 123; the E-value for the Laps domain shown below is 2.2e-43.

KSLRSKWKRKMRAEKRKKNAPRELNRLKSILRVDGDALMKDVEEIATVVVAKPRQEKMQC
EEGRCDGADEEKDDMKMETEIKRNRKTLLDQHGQYPVWMNQRQRKRLKAKREKKRGKSRA
K

Laps

PFAM accession number:	PF10169
Interpro abstract (IPR018784):	This is a family of 121-amino acid secretory proteins consisting of learning associated protein 18 (LAPS18) and related sequences. LAPS18 functions in the regulation of neuronal cell adhesion and/or movement and synapse attachment [ (PUBMED:11168596) ]. It has been shown to bind to the ApC/EBP (Aplysia CCAAT/enhancer binding protein) promoter and activate the transcription of ApC/EBP mRNA [ (PUBMED:16504946) ].

PFAM accession number:

PF10169

Interpro abstract (IPR018784):

This is a family of 121-amino acid secretory proteins consisting of learning associated protein 18 (LAPS18) and related sequences. LAPS18 functions in the regulation of neuronal cell adhesion and/or movement and synapse attachment [ (PUBMED:11168596) ]. It has been shown to bind to the ApC/EBP (Aplysia CCAAT/enhancer binding protein) promoter and activate the transcription of ApC/EBP mRNA [ (PUBMED:16504946) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Laps