The domain within your query sequence starts at position 164 and ends at position 334; the E-value for the Ldh_1_C domain shown below is 9.6e-25.
CNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDN DSENWKEVHKMVVDSAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYG IENEVFLSLPCILNARGLTSVINQKLKDDEVAQLRKSADTLWDIQKDLKDL
Ldh_1_C |
![]() |
---|
PFAM accession number: | PF02866 |
---|---|
Interpro abstract (IPR022383): | L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [ (PUBMED:11276087) ]. L-lactate dehydrogenase is also found as a lens crystallin in bird and crocodile eyes. L-2-hydroxyisocaproate dehydrogenases are also members of the family. Malate dehydrogenases catalyse the interconversion of malate to oxaloacetate [ (PUBMED:8117664) ]. The enzyme participates in the citric acid cycle. This entry represents the C-terminal, and is thought to be an is an unusual alpha+beta fold. |
GO process: | oxidation-reduction process (GO:0055114) |
GO function: | oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor (GO:0016616) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ldh_1_C