The domain within your query sequence starts at position 21 and ends at position 160; the E-value for the Ldh_1_N domain shown below is 3e-53.

NKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLKTPKIVSS
KDYCVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPHCKLLIVSNPV
DILTYVAWKISGFPKNRVIG

Ldh_1_N

Ldh_1_N
PFAM accession number:PF00056
Interpro abstract (IPR001236):

L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [ (PUBMED:11276087) ]. L-lactate dehydrogenase is also found as a lens crystallin in bird and crocodile eyes. L-2-hydroxyisocaproate dehydrogenases are also members of the family. Malate dehydrogenases catalyse the interconversion of malate to oxaloacetate [ (PUBMED:8117664) ]. The enzyme participates in the citric acid cycle.

This entry represents the N-terminal, and is thought to be a Rossmann NAD-binding fold.

GO process:oxidation-reduction process (GO:0055114)
GO function:oxidoreductase activity (GO:0016491)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ldh_1_N