The domain within your query sequence starts at position 50 and ends at position 189; the E-value for the Ldh_1_N domain shown below is 2.5e-52.
LVDVMEDKLKGEMMDLQHGSLFLKTPKIVSSKDYCVTANSKLVIITAGARQQEGESRLNL VQRNVNIFKFIIPNIVKYSPHCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSAR FRYLMGERLGVHALSCHGWV
Ldh_1_N |
---|
PFAM accession number: | PF00056 |
---|---|
Interpro abstract (IPR001236): | L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [ (PUBMED:11276087) ]. L-lactate dehydrogenase is also found as a lens crystallin in bird and crocodile eyes. L-2-hydroxyisocaproate dehydrogenases are also members of the family. Malate dehydrogenases catalyse the interconversion of malate to oxaloacetate [ (PUBMED:8117664) ]. The enzyme participates in the citric acid cycle. This entry represents the N-terminal, and is thought to be a Rossmann NAD-binding fold. |
GO process: | oxidation-reduction process (GO:0055114) |
GO function: | oxidoreductase activity (GO:0016491) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ldh_1_N