The domain within your query sequence starts at position 32 and ends at position 256; the E-value for the Lectin_leg-like domain shown below is 2.7e-53.
RRFEYKLSFKGPRLAVPGAGIPFWSHHGDAILGLEEVRLVPSMKNRSGAVWSNISVSFPS WEVEMQMRVTGPGRRGAQGVAMWYTKDRAQVGSVVEELASWDGIGIYFDSSTSDVQDSPV IRVLASDGHDLQEQSGDGNVRELGSCHRDFRNRPFPFRARVTYWRQRLRVSLSGGLTPKD PEEVCVDVEPLFLAPGGFFGVSAATGTLAADDHDVLSFLTFSLRE
Lectin_leg-like |
![]() |
---|
PFAM accession number: | PF03388 |
---|---|
Interpro abstract (IPR005052): | Lectins are structurally diverse proteins that bind to specific carbohydrates. This family includes the VIP36 and ERGIC-53 lectins. These two proteins were the first members of the family of animal lectins similar to the leguminous plant lectins [ (PUBMED:8205612) ]. The alignment for this family is towards the N terminus, where the similarity of VIP36 and ERGIC-53 is greatest. Although they have been identified as a family of animal lectins, this alignment also includes yeast sequences[ (PUBMED:8205612) ]. ERGIC-53 is a 53kDa protein, localised to the intermediate region between the endoplasmic reticulum and the Golgi apparatus (ER-Golgi-Intermediate Compartment, ERGIC). It was identified as a calcium-dependent, mannose-specific lectin [ (PUBMED:8868475) ]. Its dysfunction has been associated with combined factors V and VIII deficiency, suggesting an important and substrate-specific role for ERGIC-53 in the glycoprotein-secreting pathway [ (PUBMED:8868475) (PUBMED:10090935) ]. The L-type lectin-like domain has an overall globular shape composed of a beta-sandwich of two major twisted antiparallel beta-sheets. The beta-sandwich comprises a major concave beta-sheet and a minor convex beta-sheet, in a variation of the jelly roll fold [ (PUBMED:11850423) (PUBMED:14643651) (PUBMED:16439369) (PUBMED:17652092) ]. |
GO component: | membrane (GO:0016020) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Lectin_leg-like