The domain within your query sequence starts at position 375 and ends at position 537; the E-value for the Leo1 domain shown below is 5.8e-58.

YFVKLPNFLSVEPRPFDPQYYEDEFEDEEMLDEEGRTRLKLKVENTIRWRIRRDEEGNEI
KESNARIVKWSDGSMSLHLGNEVFDVYKAPLQGDHNHLFIRQGTGLQGQAVFKTKLTFRP
HSTDSATHRKMTLSLADRCSKTQKIRILPMAGRDPECQRTEMI

Leo1

 Leo1
PFAM accession number:PF04004
Interpro abstract (IPR007149):

In budding yeasts, Leo1 is part of the Paf1 complex, an RNA polymerase II-associated protein complex containing Paf1, Cdc73, Ctr9, Rtf1 and Leo1. Paf1 complex is involved in histone modifications, transcription elongation and other gene expression processes that include transcript site selection [ (PUBMED:20178742) ].

This entry also includes Leo1 homologues from animals and plants. Human Leo1, also known as RDL, is a component of the human Paf1 complex (Paf1C), which consists of Paf1, Cdc73, Ctr9, Rtf1, Leo1 and Wdr61 (Ski8). As in yeast, the human Paf1C has a central role in co-transcriptional histone modifications [ (PUBMED:20178742) ]. Human Leo1 promotes senescence of 2BS fibroblasts [ (PUBMED:15791002) ].

Arabidopsis Paf1C related proteins such as VIP4 (Leo1), VIP5 (Rtf1), ELF7 (Paf1), ELF8 (Ctr9) and ATXR7 (Set1) are required for the induction of seed dormancy. They control both germination and flowering time [ (PUBMED:21799800) ].

GO process:transcription elongation from RNA polymerase II promoter (GO:0006368), histone modification (GO:0016570)
GO component:Cdc73/Paf1 complex (GO:0016593)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Leo1