The domain within your query sequence starts at position 24 and ends at position 111; the E-value for the Lep_receptor_Ig domain shown below is 2.3e-30.
ESCGHIEISPPVVRLGDPVLASCTISPNCSKLDQQAKILWRLQDEPIQPGDRQHHLPDGT QESLITLPHLNYTQAFLFCLVPWEDSVQ
Lep_receptor_Ig |
![]() |
---|
PFAM accession number: | PF06328 |
---|---|
Interpro abstract (IPR010457): | This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) [ (PUBMED:9501088) ]. The two cysteine residues form a disulphide bridge. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Lep_receptor_Ig