The domain within your query sequence starts at position 23 and ends at position 167; the E-value for the Leptin domain shown below is 5.8e-71.
PIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVY QQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYST EVVALSRLQGSLQDILQQLDVSPEC
Leptin |
---|
PFAM accession number: | PF02024 |
---|---|
Interpro abstract (IPR000065): | Leptin, a metabolic monitor of food intake and energy need, is expressed by the ob obesity gene. The protein may function as part of a signalling pathway from adipose tissue that acts to regulate the size of the body fat depot [ (PUBMED:7984236) ], the hormone effectively turning the brain's appetite message off when it senses that the body is satiated. Obese humans have high levels of the protein, suggesting a similarity to type II (adult onset) diabetes, in which sufferers over-produce insulin, but can't respond to it metabolically - they have become insulin resistant. Similarly, it is thought that obese individuals may be leptin resistant. |
GO process: | signal transduction (GO:0007165) |
GO component: | extracellular region (GO:0005576) |
GO function: | hormone activity (GO:0005179) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Leptin