The domain within your query sequence starts at position 1 and ends at position 55; the E-value for the Lipin_mid domain shown below is 2.3e-20.

XPNLVIRIYNRYYNWALAAPMILSLQVFQKSLPKATVESWVKDKMPKKSGRWWFW

Lipin_mid

Lipin_mid
PFAM accession number:PF16876
Interpro abstract (IPR031703):

This is a middle domain of lipins. Overall the enzyme acts as a magnesium-dependent phosphatidate phosphatase enzyme that catalyses the conversion of phosphatidic acid to diacylglycerol during triglyceride, phosphatidylcholine and phosphatidylethanolamine biosynthesis ( EC 5.2.1.8 ) [ (PUBMED:17158099) (PUBMED:22134922) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Lipin_mid