The domain within your query sequence starts at position 213 and ends at position 504; the E-value for the Lung_7-TM_R domain shown below is 3e-100.
DDQEGLYSLYFHKCSGNNVKPGEQASFSLNIAITEKNPNSYLSAGEIPLPKLYVSMALFF FLSGTIWIHILRKRRNDVFKIHWLMAALPFTKSLSLVFHAIDYHYISSQGFPIEGWAVVY YITHLLKGALLFITIALIGTGWAFIKHILSDKDKKIFMIVIPLQVLANVAYIIIESTEEG TTEYGLWKDSLFLVDLLCCGAILFPVVWSIRHLQEASATDGKAAINLAKLRLFRHYYVLI VCYIYFTRIIAFLLKFAVPFQWKWLYQLLDETATLVFFVLTGYKFRPASDNP
Lung_7-TM_R |
![]() |
---|
PFAM accession number: | PF06814 |
---|---|
Interpro abstract (IPR009637): | This entry represents a group of transmembrane proteins, including mammalian lung seven transmembrane receptor GPR107 and GPR108. GPR107 localizes to the trans-Golgi network and is essential for retrograde transport [ (PUBMED:25031321) ]. This entry also includes proteins from fungi and plants [ (PUBMED:17454009) ]. The plant proteins in this entry, including CAND6 and CAND7, are predicted to be G-protein coupled receptors [ (PUBMED:18671868) ]. |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Lung_7-TM_R