The domain within your query sequence starts at position 85 and ends at position 318; the E-value for the M-inducer_phosp domain shown below is 3.6e-69.
LDSPGPLDSKENLEISLTRINSLPQKLLGCSPALKRSHSDSLDHDTFHLIDQDENKENEA FEFKKPIRPASRHIYEESKDPFTHRQNSAPARMLSSNESESGNFSPLFIPQSPVKATLSD EDDGFIDLLDGENMKNDEETPSCMASLWTAPLVMRRPANLADRCGLFDSPSPCGSSTRAV LKRADRSHEEPPRGTKRRKSVPSPVKAKADVPEPAQLPSQSLSLMSSPKGTIEN
M-inducer_phosp |
![]() |
---|
PFAM accession number: | PF06617 |
---|---|
Interpro abstract (IPR000751): | M-phase inducer phosphatases function as dosage-dependent inducers in mitotic control [ (PUBMED:1836978) (PUBMED:2120044) (PUBMED:8156993) (PUBMED:1392080) ]. They are tyrosine protein phosphatases required for progression of the cell cycle. They may directly dephosphorylate p34(cdc2) and activate p34(cdc2) kinase activity. They catalyse the reaction: |
GO process: | positive regulation of cell cycle G2/M phase transition (GO:1902751), protein dephosphorylation (GO:0006470) |
GO function: | protein tyrosine phosphatase activity (GO:0004725) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry M-inducer_phosp