The domain within your query sequence starts at position 3 and ends at position 153; the E-value for the MAGP domain shown below is 1.2e-62.

MRAACLFLLFMPGLLAQGQYDLDPLPPFPDHVQYNHYGDQIDNADYYDYQEVSPRTPEEQ
FQSQQQVQQEVIPAPTPEPAAAGDLETEPTEPGPLDCREEQYPCTRLYSIHKPCKQCLNE
VCFYSLRRVYVVNKEICVRTVCAHEELLRAD

MAGP

 MAGP
PFAM accession number:PF05507
Interpro abstract (IPR008673):

This family consists of several mammalian microfibril-associated glycoprotein (MAGP) 1 and 2 proteins. MAGP1 and 2 are components of elastic fibres. MAGP-1 has been proposed to bind a C-terminal region of tropoelastin, the soluble precursor of elastin. MAGP-2 was found to interact with fibrillin-1 and -2, as well as fibulin-1, another component of elastic fibres. This suggests that MAGP-2 may be important in the assembly of microfibrils [ (PUBMED:12122015) ].

GO component:microfibril (GO:0001527)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MAGP